Skype
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  1  2  3  4  5  *
CHEMICAL products beginning with : D
6551 to 6600 of 38550 results  Page: << Previous 50 Results 120 121 122 123 124 125 126 127 128 129 130 131 [132] 133 134 135 136 137 138 139 140 >> Next 50 Results
 PRODUCT NAMECAS Registry Number 
DACURONIUM (4 suppliers)
Compound Structure IUPAC Name: [(3S,5S,10S,13S,17R)-17-hydroxy-10,13-dimethyl-2,16-bis(1-methylpiperidin-1-ium-1-yl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-3-yl] acetate | CAS Registry Number: 43021-45-0
Synonyms: Dacuronium, 17-Hydroxypancuronium, Androstane, piperidinium deriv., CID162536

Molecular Formula: C33H58N2O3+2Molecular Weight: 530.825220 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 3

InChIKey: XQFBAGUGBNQLRT-CSJYSYQFSA-N

43021-45-0
DACURONIUM BROMIDE (6 suppliers)
Compound Structure IUPAC Name: [(2S,3S,5S,10S,13S)-17-hydroxy-10,13-dimethyl-2,16-bis(1-methylpiperidin-1-ium-1-yl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-3-yl] acetate dibromide | CAS Registry Number: 27115-86-2
Synonyms: Dacuronium Bromide, Dacuronii bromidum, Bromuro de dacuronio, Bromure de dacuronium, Org 6368, NB68, Dacuronii bromidum [INN-Latin], Dacuronium bromide [BAN:INN], NB 68, Bromure de dacuronium [INN-French], Bromuro de dacuronio [INN-Spanish], EINECS 248-233-9, CID71705, UNII-33482245B6, LS-116477, 2-beta, 16-beta-Dipiperidino-5-alpha-androstan-3-alpha,17-beta-diol 3-acetate dimethobromide, 3-alpha-Acetoxy-2-beta,16-beta-dipiperidino-5-alpha-androstan-17-beta-ol dimethobromide, 5alpha-Androstan-3alpha,17beta-diol, 2beta,16beta-dipipecolinio-, dibromide, 3alpha-acetate, 1,1'-((2bea,3alpha,5alpha,16beta,17beta)-3-(Acetyloxy)-17-hydroxyandrostane-2,16-diyl)bis(1-methylperidinium)dibromide, Piperidinium, 1,1'-(2-beta,16-beta-(3-alpha,17-beta-dihydroxy-5-alpha-androstanylene))bis(1-methyl-, dibromide, 3-alpha-acetate

Molecular Formula: C33H58Br2N2O3Molecular Weight: 690.633220 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 5

InChIKey: SUKULMJPMHYWKC-ASCUVKKQSA-L

27115-86-2
Dadahol A (6 suppliers)
Compound Structure IUPAC Name: [(E)-3-[4-[(1S,2R)-1-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-[(E)-3-(4-hydroxyphenyl)prop-2-enoyl]oxypropan-2-yl]oxy-3,5-dimethoxyphenyl]prop-2-enyl] (E)-3-(4-hydroxyphenyl)prop-2-enoate | CAS Registry Number: 405281-76-7
Synonyms: MolPort-035-706-067, C39H38O12, ZINC49888876, W1843

Molecular Formula: C39H38O12Molecular Weight: 698.721 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 12

InChIKey: IKHAPHPJWABCCU-PQUVRFHRSA-N

405281-76-7
DADHP (2 suppliers)
Compound Structure IUPAC Name: 6,7-diphenyl-2,3-dihydro-1H-pyrrolizine | CAS Registry Number: 73009-82-2
Synonyms: CHEBI:334889, CID155766, 6,7-Diphenyl-2,3-dihydro-1H-pyrrolizine, 2,3-Dihydro-6,7-diphenyl-1H-pyrrolizine, 1H-Pyrrolizine, 2,3-dihydro-6,7-diphenyl-

Molecular Formula: C19H17NMolecular Weight: 259.344980 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 0

InChIKey: KTNZDKBUNJCAGR-UHFFFAOYSA-N

73009-82-2
DADMAC/AM Copolymer (0 suppliers)25590-05-6
Dadmac/Dmdaac (3 suppliers)7398-6-98
DAECHUINE S 8-1 (2 suppliers)
Compound Structure Synonyms: Daechuine S8-1

Molecular Formula: C34H53N5O6Molecular Weight: 627.827 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 7

InChIKey: JNBWNLPBFQTODE-OWBHPGMISA-N

123089-23-6
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (1 supplier)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG (1 supplier)
DAEMONOROPS DRACO EXTRACT (3 suppliers)84776-31-8
DAF-2 (5 suppliers)
Compound Structure IUPAC Name: 5,6-diamino-3',6'-dihydroxyspiro[2-benzofuran-3,9'-xanthene]-1-one | CAS Registry Number: 205391-01-1
Synonyms: 4,5-Diaminofluorescein, SureCN8383527, CTK8F1067

Molecular Formula: C20H14N2O5Molecular Weight: 362.335560 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 7

InChIKey: LTYUPYUWXRTNFQ-UHFFFAOYSA-N

205391-01-1
DAF-2 DIACETATE (7 suppliers)
Compound Structure IUPAC Name: (6'-acetyloxy-5,6-diamino-3-oxospiro[2-benzofuran-1,9'-xanthene]-3'-yl) acetate | CAS Registry Number: 205391-02-2
Synonyms: 4,5-Diaminofluorescein diacetate, DAF-2 DA, 5,6-Diaminofluorescein diacetate, AC1O7FZ6, DAF-2 DA (cell permeable), 50277_FLUKA, 50277_SIGMA, CTK8E7129, (6'-acetyloxy-5,6-diamino-3-oxospiro[2-benzofuran-1,9'-xanthene]-3'-yl) acetate, 4,5-Diaminofluorescein diacetate-3',6'-bis(acetyloxy)-5,6-diamino-spiro[isobenzofuran-1(3H),9'-[9H]xanthen]-3-one

Molecular Formula: C24H18N2O7Molecular Weight: 446.408920 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 9

InChIKey: PTSUYDXEEKDBQU-UHFFFAOYSA-N

205391-02-2
DAF-2T (5 suppliers)
Compound Structure IUPAC Name: 3',6'-dihydroxyspiro[2H-furo[3,4-f]benzotriazole-7,9'-4a,9a-dihydroxanthene]-5-one | CAS Registry Number: 208850-35-5
Synonyms: CTK8F0991

Molecular Formula: C20H13N3O5Molecular Weight: 375.334320 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 7

InChIKey: OIFYZGJSZBYAJU-UHFFFAOYSA-N

208850-35-5
DAF-789 (2 suppliers)57657-08-6
Dafadine-A (4 suppliers)
Compound Structure IUPAC Name: [5-[(2,6-dimethylphenoxy)methyl]-1,2-oxazol-3-yl]-(4-pyridin-4-ylpiperidin-1-yl)methanone | CAS Registry Number: 1065506-69-5
Synonyms: CHEBI:88327, dafadine A, Ambcb24199950, MLS001090772, CHEMBL1585869, AOB1841, SYN5016, HMS2928H15, 3571AH, ZINC12373493, AKOS000365820, CS-3184, HY-16670, SMR000654704, KB-272050, {5-[(2,6-dimethylphenoxy)methyl]-1,2-oxazol-3-yl}[4-(pyridin-4-yl)piperidin-1-yl]methanone

Molecular Formula: C23H25N3O3Molecular Weight: 391.471 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 5

InChIKey: WNSNPYIHDMIFOO-UHFFFAOYSA-N

1065506-69-5
daffodil flower water (2 suppliers)90064-27-0
Daflon (0 suppliers)
Compound Structure IUPAC Name: 5-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-7-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxymethyl]oxan-2-yl]oxychromen-4-one;(2S)-5-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-7-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxymethyl]oxan-2-yl]oxy-2,3-dihydrochromen-4-one | CAS Registry Number: 111804-73-0
Synonyms: Capiven, Detralex, Venitol, Arvenum 500, S5682, S 5682, S-5682

Molecular Formula: C56H66O30Molecular Weight: 1219.105240 [g/mol]
H-Bond Donor: 16H-Bond Acceptor: 30

InChIKey: UPZXYHXBFVZRHQ-RSZBNIDCSA-N

111804-73-0
DAG-OIL (3 suppliers)308082-33-9
DAGA PROTEIN,ALTEROMONAS HALOPLANKTIS (3 suppliers)148349-99-9
DAGAPAMIL (3 suppliers)
Compound Structure IUPAC Name: 2-[3-[2-(3-methoxyphenyl)ethyl-methylamino]propyl]-2-(3,4,5-trimethoxyphenyl)tetradecanenitrile | CAS Registry Number: 85247-76-3
Synonyms: Dagapamil, Dagapamilum, Dagapamil [INN], UNII-64O87U613H, CID205957

Molecular Formula: C36H56N2O4Molecular Weight: 580.840840 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 6

InChIKey: BGCVNLXQFOHWMO-UHFFFAOYSA-N

85247-76-3
DAGLUTRILUM (3 suppliers)
Compound Structure IUPAC Name: 2-[(3S)-3-[[1-[(2R)-2-ethoxycarbonyl-4-phenylbutyl]cyclopentanecarbonyl]amino]-2-oxo-4,5-dihydro-3H-1-benzazepin-1-yl]acetic acid | CAS Registry Number: 182821-27-8
Synonyms: Daglutril, SLV-306, SLV306, UNII-KKV299446X, CID3038505, LS-182213, 1H-1-Benzazepine-1-acetic acid, 3-(((1-((2R)-2-(ethoxycarbonyl)-4-phenylbutyl)cyclopentyl)carbonyl)amino)-2,3,4,5-tetrahydro-2-oxo-, (3S)-, 1H-1-Benzazepine-1-acetic acid, 3-(((1-(2-(ethoxycarbonyl)-4-phenylbutyl)cyclopentyl)carbonyl)amino)-2,3,4,5-tetrahydro-2-oxo-, (S-(R*,S*))-, ((3S)-3-{1-((2R)-2-Ethoxycarbonyl-4-phenylbutyl)cyclopentanecarboxamido}-2-oxo-2,3,4,5-tetrahydro-1H-1-benzazepin-1-yl)acetic acid

Molecular Formula: C31H38N2O6Molecular Weight: 534.643220 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 6

InChIKey: XMQODGUTLZXUGZ-RPBOFIJWSA-N

182821-27-8
DAGO (3 suppliers)
Dahllite (0 suppliers)66524-19-4
DAHPC (4 suppliers)
Compound Structure IUPAC Name: 2-(dodecanoylamino)hexyl 2-(trimethylazaniumyl)ethyl phosphate | CAS Registry Number: 131736-67-9
Synonyms: Amide-PC, CHEBI:247818, CID131415, 2-Dodecanoylamino-1-hexanolphosphocholine, (R)-{2-[(2-Dodecanoylamino-hexyloxy)-hydroxy-phosphoryloxy]-ethyl}-trimethyl-ammonium

Molecular Formula: C23H49N2O5PMolecular Weight: 464.619321 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 5

InChIKey: NZECISUDKBBTDE-UHFFFAOYSA-N

131736-67-9
Dahurian Rhododendron Leaf P.E (0 suppliers)
Dahurian Rhodoendron Extract (1 supplier)
Dahurian Rhodoendron Leaf Extract (0 suppliers)
DAI-TUNICAMINE (4 suppliers)
Compound Structure Synonyms: Dai-tunicamine, Deaminotri-O-isopropylidene tunicamine, CID3083348, 5-C-(6-Deoxy-1,2-3,4-di-O-isopropylidene-D-galactopyranos-6-yl)-2,3-O-isopropylidene-D-pentofuranose, L-allo-alpha-D-galacto-Undecodialdo-1,5-pyranose, 6-deoxy-1,2:3,4:9,10-tris-O-(1-methylethylidene)-

Molecular Formula: C20H32O10Molecular Weight: 432.462080 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 10

InChIKey: DCBBUGKPMCTVKE-UHFFFAOYSA-N

142010-67-1
daidai peel cp oil (1 supplier)977185-28-6
Daidzein (79 suppliers)
Compound Structure IUPAC Name: 7-hydroxy-3-(4-hydroxyphenyl)chromen-4-one | CAS Registry Number: 486-66-8
Synonyms: daidzein, Daidzeol, Diadzein, Isoaurostatin, 4',7-Dihydroxyisoflavone, 7,4'-Dihydroxyisoflavone, Daidzein (6CI), nchembio.76-comp16, Spectrum_000255, Tocris-1417, BiomolKI_000060, Spectrum2_000053, Spectrum3_000191, Spectrum4_001964, Spectrum5_000857, Lopac-D-7802, BiomolKI2_000066, UPCMLD-DP052, CCRIS 7600, Lopac0_000412

Molecular Formula: C15H10O4Molecular Weight: 254.237500 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 4

InChIKey: ZQSIJRDFPHDXIC-UHFFFAOYSA-N

486-66-8
Daidzein 4'-?-D-Glucuronide (6 suppliers)
Compound Structure IUPAC Name: (2S,3S,4S,5R,6S)-3,4,5-trihydroxy-6-[4-(7-hydroxy-4-oxochromen-3-yl)phenoxy]oxane-2-carboxylic acid | CAS Registry Number: 264236-77-3
Synonyms: Daidzein 4'-|A-D-Glucuronide, ACon1_002386, NCGC00169894-01, 4-(7-Hydroxy-4-oxo-4H-1-benzopyran-3-yl)phenyl |A-D-Glucopyranosiduronic Acid

Molecular Formula: C21H18O10Molecular Weight: 430.361620 [g/mol]
H-Bond Donor: 5H-Bond Acceptor: 10

InChIKey: ATUYSKUVHUPXBV-ZFORQUDYSA-N

264236-77-3
Daidzein 4'-Sulfate Disodium Salt (0 suppliers)
Daidzein 7-?-D-Glucuronide 4'-Sulfate Disodium Salt (6 suppliers)
Compound Structure IUPAC Name: disodium;(2S,3S,4S,5R,6S)-3,4,5-trihydroxy-6-[4-oxo-3-(4-sulfonatooxyphenyl)chromen-7-yl]oxyoxane-2-carboxylate | CAS Registry Number: 1041134-19-3
Synonyms: Daidzein 7-|A-D-Glucuronide 4'-Sulfate Disodium Salt, 4-Oxo-3-[4-(sulfooxy)phenyl]-4H-1-benzopyran-7-yl |A-D-Glucopyranosiduronic Acid Sodium Salt

Molecular Formula: C21H16Na2O13SMolecular Weight: 554.388479 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 13

InChIKey: VHQPHYREJFCKGH-DSGPYVBMSA-L

1041134-19-3
Daidzein 7-?-D-Glucuronide Methyl Ester (0 suppliers)
Daidzein 7-?-D-Glucuronide Potassium Salt (0 suppliers)
Daidzein 7-O-beta-D-glucoside 4''-O-methylate (5 suppliers)
Compound Structure IUPAC Name: 7-[(2S,3R,4R,5S,6R)-3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]oxy-3-(4-hydroxyphenyl)chromen-4-one | CAS Registry Number: 1195968-02-5
Synonyms: 4''-methyloxy-Daidzin, AKOS030530147, ZINC207825965, 4'-Hydroxy-7-(4-O-methyl-beta-D-glucopyranosyloxy)isoflavone

Molecular Formula: C22H22O9Molecular Weight: 430.409 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 9

InChIKey: BVKFFAQGFXJQBI-MSEOUXRUSA-N

1195968-02-5
Daidzein 7-Tri-O-acetyl-?-D-glucuronic Acid Methyl Ester (6 suppliers)
Compound Structure IUPAC Name: methyl (2S,3S,4S,5R,6S)-3,4,5-triacetyloxy-6-[3-(4-hydroxyphenyl)-4-oxochromen-7-yl]oxyoxane-2-carboxylate | CAS Registry Number: 1041134-15-9
Synonyms: FT-0665454, Daidzein 7-Tri-O-acetyl-|A-D-glucuronic Acid Methyl Ester, 3-(4-Hydroxyphenyl)-4-oxo-4H-1-benzopyran-7-yl 7-|A-D-Glucopyranosiduronic Acid Methyl Ester 2,3,4-Triacetate

Molecular Formula: C28H26O13Molecular Weight: 570.498240 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 13

InChIKey: ZHWYIYHBFWANGL-YYDZWWTMSA-N

1041134-15-9
Daidzein 7-Tri-O-acetyl-?-D-glucuronic Acid Methyl Ester 4'-Sulfate (6 suppliers)
Compound Structure IUPAC Name: methyl (2S,3S,4S,5R,6S)-3,4,5-triacetyloxy-6-[4-oxo-3-(4-sulfooxyphenyl)chromen-7-yl]oxyoxane-2-carboxylate | CAS Registry Number: 1041261-16-8
Synonyms: Daidzein 7-Tri-O-acetyl-|A-D-glucuronic Acid Methyl Ester 4'-Sulfate, 3-(4-Hydroxyphenyl)-4-oxo-4H-1-benzopyran-7-yl |A-D-Glucopyranosiduronic Acid Methyl Ester 2,3,4-Triacetate 4 inverted exclamation mark -Sulfate

Molecular Formula: C28H26O16SMolecular Weight: 650.561440 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 16

InChIKey: YLYDFNVTVUNKCE-YYDZWWTMSA-N

1041261-16-8
DAIDZEIN DIACETATE (10 suppliers)
Compound Structure IUPAC Name: [4-(7-acetyloxy-4-oxochromen-3-yl)phenyl] acetate | CAS Registry Number: 3682-01-7
Synonyms: Daidzein diacetate, 7,4'-Diacetoxyisoflavone, SureCN1724568, 4',7-Diacetyl-O-isoflavone, 4',7-Dihydroxy-isoflavone Diacetate, FT-0665447, 7-(Acetyloxy)-3-[4-(acetyloxy)phenyl]-4H-1-benzopyran-4-one

Molecular Formula: C19H14O6Molecular Weight: 338.310860 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 6

InChIKey: OHNNFNBOPWLDFH-UHFFFAOYSA-N

3682-01-7
Daidzein Diglucuronide (1 supplier)335591-27-0
Daidzein,98% (0 suppliers)488-66-8
DAIDZEIN-3',5',8-D3 (7 suppliers)
Compound Structure IUPAC Name: 8-deuterio-3-(3,5-dideuterio-4-hydroxyphenyl)-7-hydroxychromen-4-one | CAS Registry Number: 220930-96-1
Synonyms: Daidzein-3',5',8-d3, 4',7-Dihydroxyisoflavone-d3, CTK8F0992, 7-Hydroxy-3-(4-hydroxyphenyl-3,5-d2)-4H-1-benzopyran-4-one-8-d

Molecular Formula: C15H10O4Molecular Weight: 257.255985 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 4

InChIKey: ZQSIJRDFPHDXIC-BKWFQMGFSA-N

220930-96-1
DAIDZEIN-4,7-DIGLUCOSIDE (3 suppliers)
Compound Structure IUPAC Name: 7-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3-[4-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyphenyl]chromen-4-one | CAS Registry Number: 53681-67-7
Synonyms: Daidzein-4,7-diglucoside, CID171292, 4H-1-Benzopyran-4-one, 7-(beta-D-glucopyranosyloxy)-3-(4-(beta-D-glucopyranosyloxy)phenyl)-

Molecular Formula: C27H30O14Molecular Weight: 578.518700 [g/mol]
H-Bond Donor: 8H-Bond Acceptor: 14

InChIKey: VWEWSCDQMVNOJP-IPOZFMEPSA-N

53681-67-7
Daidzein-7-O-Glucuronide,Assay (Hplc) , 95% (4 suppliers)38482-80-3
DAIDZEIN-D3-7-O-B-D-GLUCOPYRANOSIDE (2 suppliers)220930-97-2
Daidzein-d4(4-hydroxyphenyl-2,3,5,6-d4) (3 suppliers)
Compound Structure IUPAC Name: 7-hydroxy-3-(2,3,5,6-tetradeuterio-4-hydroxyphenyl)chromen-4-one | CAS Registry Number: 1219803-57-2
Synonyms: ZQSIJRDFPHDXIC-RHQRLBAQSA-N, daidzein-d4 (4-hydroxyphenyl-2,3,5,6-d4)

Molecular Formula: C15H10O4Molecular Weight: 258.265 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 4

InChIKey: ZQSIJRDFPHDXIC-RHQRLBAQSA-N

1219803-57-2
Daidzin (43 suppliers)
Compound Structure IUPAC Name: 3-(4-hydroxyphenyl)-7-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxychromen-4-one | CAS Registry Number: 552-66-9
Synonyms: Daidzoside, Daidzein 7-glucoside, Daidzein-7-glucoside, Daidzein 7-O-glucoside, Ambap7584, 4',7-Dihydroxyisoflavone, daidzein 7-O-beta-D-glucoside, nchembio.2007.28-comp34, MEGxp0_000530, 7-O-B-D-GLUCOPYRANOSIDE, 30408_FLUKA, ACon1_002092, CHEBI:42202, BRN 0059741, Daidzein-7-O-beta-D-glucopyranoside, CID107971, NCGC00163532-01, NCGC00179839-01, LS-39679, C10216

Molecular Formula: C21H20O9Molecular Weight: 416.378100 [g/mol]
H-Bond Donor: 5H-Bond Acceptor: 9

InChIKey: KYQZWONCHDNPDP-QNDFHXLGSA-N

552-66-9
Daidzin, from Soybean (1 supplier)000552-66-9
Daiflon S 2T (0 suppliers)125651-66-3
DAIGREDORIGENIN (1 supplier)99347-38-3
6551 to 6600 of 38550 results  Page: << Previous 50 Results 120 121 122 123 124 125 126 127 128 129 130 131 [132] 133 134 135 136 137 138 139 140 >> Next 50 Results
Alphabetical Products   |   ALL 20,000 Suppliers
HomeBuyAdd FREE ListingAdvertise Chemical Company