Skype
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  1  2  3  4  5  *
CHEMICAL products beginning with : D
6751 to 6800 of 41252 results  Page: << Previous 50 Results 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 [136] 137 138 139 140 >> Next 50 Results
 PRODUCT NAMECAS Registry Number 
Dacp (4 suppliers)
Compound Structure IUPAC Name: 5-diazocyclopenta-1,3-diene | CAS Registry Number: 1192-27-4
Synonyms: 5-Diazo-1,3-cyclopentadiene, 1,3-Cyclopentadiene,5-diazo-, 5-diazocyclopenta-1,3-diene, AC1L39L8

Molecular Formula: C5H4N2Molecular Weight: 92.098660 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 1

InChIKey: UETCMNDFHMOYSP-UHFFFAOYSA-N

1192-27-4
DACRENE (6 suppliers)
Compound Structure Synonyms: (-)-Phyllocladene

Molecular Formula: C20H32Molecular Weight: 272.476 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 0

InChIKey: ONVABDHFQKWOSV-ILOVYUIOSA-N

20070-61-5
DACRON 900F (1 supplier)60527-88-0
Dacryhainansterone (0 suppliers)
Compound Structure IUPAC Name: 17-(2,3-dihydroxy-6-methylheptan-2-yl)-2,3,14-trihydroxy-10,13-dimethyl-2,3,4,5,12,15,16,17-octahydro-1H-cyclopenta[a]phenanthren-6-one | CAS Registry Number: 83921-17-9
Synonyms: AGN-PC-00O5PJ, (2beta,3beta,5beta,17alpha,22R)-2,3,14,20,22-pentahydroxycholesta-7,9(11)-dien-6-one, 17-(2,3-dihydroxy-6-methylheptan-2-yl)-2,3,14-trihydroxy-10,13-dimethyl-2,3,4,5,12,15,16,17-octahydro-1H-cyclopenta[a]phenanthren-6-one

Molecular Formula: C27H42O6Molecular Weight: 462.618780 [g/mol]
H-Bond Donor: 5H-Bond Acceptor: 6

InChIKey: HHSAPBUKXSETPT-UHFFFAOYSA-N

83921-17-9
Dacrysterone (2 suppliers)
Compound Structure IUPAC Name: 2,3,5,14-tetrahydroxy-10,13-dimethyl-17-(2,3,6-trihydroxy-5,6-dimethylheptan-2-yl)-1,2,3,4,9,11,12,15,16,17-decahydrocyclopenta[a]phenanthren-6-one | CAS Registry Number: 50299-45-1
Synonyms: (2beta,3beta,5beta,14xi)-2,3,5,14,20,22,25-heptahydroxyergost-7-en-6-one

Molecular Formula: C28H46O8Molecular Weight: 510.660040 [g/mol]
H-Bond Donor: 7H-Bond Acceptor: 8

InChIKey: LMQKRCYKYDRRFC-UHFFFAOYSA-N

50299-45-1
Dactinomycin (6 suppliers)889-55-4
Dactinomycin for Injection 20mg/ml (0 suppliers)
Dactinomycin for Injection 500mcg (Lyophilized) (0 suppliers)
Dactylaria brochopaga (0 suppliers)67891-94-5
DACTYLARIN (4 suppliers)
Compound Structure IUPAC Name: (2R,3S)-2,3,8-trihydroxy-6-methoxy-3-methyl-2,4-dihydro-1H-anthracene-9,10-dione | CAS Registry Number: 52212-96-1
Synonyms: Dactylarin, Altersolanol B, CID161389, 22350-90-9, 3,7-Dihydroxy-2',5-dimethoxy-6'-methylspiro(benzofuran-2(3H),1'-(2,5)cyclohexadien)-4'-one, 9,10-Anthracenedione, 1,2,3,4-tetrahydro-2,3,5-trihydroxy-7-methoxy-2-methyl-, (2S,3R)-, 9,10-Anthracenedione, 1,2,3,4-tetrahydro-2,3,5-trihydroxy-7-methoxy-2-methyl-, (2S-cis)-

Molecular Formula: C16H16O6Molecular Weight: 304.294640 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 6

InChIKey: AAHQQIFXAQHGBD-WBMJQRKESA-N

52212-96-1
DACTYLFUNGIN A (6 suppliers)
Compound Structure IUPAC Name: 3-[(2S,3R,4S,6S)-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-hydroxy-6-[(4E,6E,14E,16E,18E)-3-hydroxy-8-(hydroxymethyl)-2,6,10,12,14,18,20-heptamethyldocosa-4,6,14,16,18-pentaen-2-yl]pyran-4-one | CAS Registry Number: 146935-35-5
Synonyms: Dactylfungin A, Dactylfungin B, AIDS009811, AIDS009812, AIDS-009811, AIDS-009812, CID6436261, LS-127423, 146935-36-6, 4H-Pyran-4-one, 3-(4-deoxy-beta-xylo-hexopyranosyl)-2-hydroxy-6-(2-hydroxy-7-(hydroxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosapentaenyl)-, 2H-Pyran-2-one, 3-(4-deoxy-beta-xylo-hexopyranosyl)-4-hydroxy-6-(2-hydroxy-7-(hydroxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosapentaenyl)-, 2H-Pyran-2-one,3-(4-deoxy-beta-xylo-hexopyranosyl)-4-hydroxy-6-(2-hydroxy-7-(hydroxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosa- pentaenyl)-, 4H-Pyran-4-one, 3-(4-deoxy-beta-xylo-hexopyranosyl)-2-hydroxy-6-(2-hydroxy-7-(hyd- roxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosa- pentaenyl)-(2S,3R,4S,6S)-

Molecular Formula: C41H64O9Molecular Weight: 700.941460 [g/mol]
H-Bond Donor: 6H-Bond Acceptor: 9

InChIKey: XBOURDXDRVZWJC-CKGFFVAASA-N

146935-35-5
DACTYLFUNGIN B (4 suppliers)
Compound Structure IUPAC Name: 3-[(2S,3R,4S,6S)-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-hydroxy-6-[(4E,6E,14E,16E,18E)-3-hydroxy-8-(hydroxymethyl)-2,6,10,12,14,18,20-heptamethyldocosa-4,6,14,16,18-pentaen-2-yl]pyran-4-one | CAS Registry Number: 146935-36-6
Synonyms: Dactylfungin A, Dactylfungin B, AIDS009811, AIDS009812, AIDS-009811, AIDS-009812, CID6436261, LS-127423, 146935-35-5, 4H-Pyran-4-one, 3-(4-deoxy-beta-xylo-hexopyranosyl)-2-hydroxy-6-(2-hydroxy-7-(hydroxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosapentaenyl)-, 2H-Pyran-2-one, 3-(4-deoxy-beta-xylo-hexopyranosyl)-4-hydroxy-6-(2-hydroxy-7-(hydroxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosapentaenyl)-, 2H-Pyran-2-one,3-(4-deoxy-beta-xylo-hexopyranosyl)-4-hydroxy-6-(2-hydroxy-7-(hydroxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosa- pentaenyl)-, 4H-Pyran-4-one, 3-(4-deoxy-beta-xylo-hexopyranosyl)-2-hydroxy-6-(2-hydroxy-7-(hyd- roxymethyl)-1,1,5,9,11,13,17,19-octamethyl-3,5,13,15,17-heneicosa- pentaenyl)-(2S,3R,4S,6S)-

Molecular Formula: C41H64O9Molecular Weight: 700.941460 [g/mol]
H-Bond Donor: 6H-Bond Acceptor: 9

InChIKey: XBOURDXDRVZWJC-CKGFFVAASA-N

146935-36-6
DACTYLICAPNOSININE (1 supplier)168434-28-4
DACTYLOCYCLINE A (6 suppliers)
Compound Structure IUPAC Name: (2Z)-2-[amino(hydroxy)methylidene]-7-chloro-4-(dimethylamino)-4a,10,11,12a-tetrahydroxy-6-[4-(hydroxyamino)-5-methoxy-4,6-dimethyloxan-2-yl]oxy-8-methoxy-6-methyl-5,5a-dihydro-4H-tetracene-1,3,12-trione | CAS Registry Number: 125622-12-0
Synonyms: Dactylocycline A, CID5492449

Molecular Formula: C31H40ClN3O13Molecular Weight: 698.114600 [g/mol]
H-Bond Donor: 8H-Bond Acceptor: 16

InChIKey: OTEIMOGHZYBOGA-IMRQLAEWSA-N

125622-12-0
DACTYLOCYCLINE B (6 suppliers)
Compound Structure IUPAC Name: (2Z)-2-[amino(hydroxy)methylidene]-7-chloro-4-(dimethylamino)-4a,10,11,12a-tetrahydroxy-8-methoxy-6-(5-methoxy-4,6-dimethyl-4-nitrooxan-2-yl)oxy-6-methyl-5,5a-dihydro-4H-tetracene-1,3,12-trione | CAS Registry Number: 125622-13-1
Synonyms: Dactylocycline B, CID5748436, CID 5748436, 2-Naphthacenecarboxamide, 7-chloro-4-(dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,4a,10,12,12a-pentahydroxy-8-methoxy-6-methyl-1,11-dioxo-6-((2,3,6-trideoxy-3-C-methyl-4-O-methyl-3-nitro-alpha-L-arabino-hexopyranosyl)oxy)-, (4R-(4alpha,4aalpha,5aalpha,6alpha,12aalpha))-

Molecular Formula: C31H38ClN3O14Molecular Weight: 712.098120 [g/mol]
H-Bond Donor: 6H-Bond Acceptor: 16

InChIKey: HCKLOTWXHKSTOB-IMRQLAEWSA-N

125622-13-1
DACTYLOCYCLINE D (6 suppliers)
Compound Structure IUPAC Name: [[6-[[(9Z)-9-[amino(hydroxy)methylidene]-4-chloro-7-(dimethylamino)-1,6a,10a,12-tetrahydroxy-3-methoxy-5-methyl-8,10,11-trioxo-6,7-dihydro-5aH-tetracen-5-yl]oxy]-3-methoxy-2,4-dimethyloxan-4-yl]amino] acetate | CAS Registry Number: 146064-00-8
Synonyms: Dactylocycline D, CID5492673

Molecular Formula: C33H42ClN3O14Molecular Weight: 740.151280 [g/mol]
H-Bond Donor: 7H-Bond Acceptor: 17

InChIKey: JJTBDZHJLCRCMG-BRPDVVIDSA-N

146064-00-8
DACTYLOCYCLINE E (6 suppliers)
Compound Structure IUPAC Name: (2Z)-2-[amino(hydroxy)methylidene]-7-chloro-4-(dimethylamino)-4a,10,11,12a-tetrahydroxy-6-(4-hydroxy-5-methoxy-4,6-dimethyloxan-2-yl)oxy-8-methoxy-6-methyl-5,5a-dihydro-4H-tetracene-1,3,12-trione | CAS Registry Number: 146064-01-9
Synonyms: Dactylocycline E, CID5748507, 2-Naphthacenecarboxamide, 7-chloro-6-(((2,6-dideoxy-3-C-methyl-4-O-methyl-alpha-L-arabino-hexopyranosyl)oxy)-4-(dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,4a,10,12,12a-pentahydroxy-8-methoxy-6-methyl-1,11-dioxo)-, (4R-(4alpha,4aalpha,5aalpha,6alpha,12aalpha))-

Molecular Formula: C31H39ClN2O13Molecular Weight: 683.099960 [g/mol]
H-Bond Donor: 7H-Bond Acceptor: 15

InChIKey: JMYCRZJTKCYMEZ-IMRQLAEWSA-N

146064-01-9
DACTYLOCYCLINONE (5 suppliers)
Compound Structure IUPAC Name: (2Z,4S,4aR,5aS,6S,12aS)-2-[amino(hydroxy)methylidene]-7-chloro-4-(dimethylamino)-4a,6,10,11,12a-pentahydroxy-8-methoxy-6-methyl-5,5a-dihydro-4H-tetracene-1,3,12-trione | CAS Registry Number: 110298-64-1
Synonyms: Dactylocyclinone, Sch 34164, CID5492642, LS-93883, 112077-91-5, 2-Naphthacenecarboxamide, 1,4,4a,5,5a,6,11,12a-octahydro-7-chloro-4-(dimethylamino)-1,11-dioxo-3,4a,6,10,12,12a-hexahydroxy-8-methoxy-, (4R-(4-alpha,4a-alpha,5a-alpha,6-beta,12-alpha))-, 2-Naphthacenecarboxamide, 7-chloro-4-(dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,4a,6,10,12,12a-hexahydroxy-8-methoxy-6-methyl-1,11-dioxo-, (4R-(4alpha,4aalpha,5aalpha,6beta,12aalpha))-

Molecular Formula: C23H25ClN2O10Molecular Weight: 524.905000 [g/mol]
H-Bond Donor: 7H-Bond Acceptor: 12

InChIKey: DEKVODJMAJZBBX-RLQLBRJRSA-N

110298-64-1
Dactylol (1 supplier)
Compound Structure IUPAC Name: (1R,3aS,5Z,9aS)-1,5,8,8-tetramethyl-2,3,4,7,9,9a-hexahydro-1H-cyclopenta[8]annulen-3a-ol | CAS Registry Number: 58542-75-9

Molecular Formula: C15H26OMolecular Weight: 222.372 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 1

InChIKey: FRGHPWUZLHMCQW-BBOSXGCTSA-N

58542-75-9
Dactylomycesthermophilus (0 suppliers)67891-95-6
Dactylorhin A (6 suppliers)
Compound Structure IUPAC Name: bis[[4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyphenyl]methyl] (2R)-2-(2-methylpropyl)-2-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxybutanedioate | CAS Registry Number: 256459-34-4

Molecular Formula: C40H56O22Molecular Weight: 888.900 [g/mol]
H-Bond Donor: 12H-Bond Acceptor: 22

InChIKey: QUCKZYFUROTIBC-XREANIFXSA-N

256459-34-4
Dactylorhin B (1 supplier)256459-36-6
Dactylorhin C (1 supplier)
Compound Structure IUPAC Name: (2R)-2-(2-methylpropyl)-2-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxybutanedioic acid | CAS Registry Number: 256459-23-1
Synonyms: Butanedioic acid, 2-(beta-D-glucopyranosyloxy)-2-(2-methylpropyl)-, (2R)-, (2R)-2-(2-methylpropyl)-2-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxybutanedioic acid

Molecular Formula: C14H24O10Molecular Weight: 352.330 [g/mol]
H-Bond Donor: 6H-Bond Acceptor: 10

InChIKey: RLSITCAUHUNHRO-BGWRNRDFSA-N

256459-23-1
Dactylospongenone B (0 suppliers)123123-34-2
Dactyloxene B (1 supplier)
Compound Structure IUPAC Name: (2R,5R,9S,10R)-2-ethenyl-2,6,9,10-tetramethyl-1-oxaspiro[4.5]dec-6-ene | CAS Registry Number: 54928-03-9

Molecular Formula: C15H24OMolecular Weight: 220.356 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 1

InChIKey: CVZXLAAMZXBCMM-ATGSNQNLSA-N

54928-03-9
DACTYLYNE (4 suppliers)
Compound Structure IUPAC Name: (2R,3R,5S,6S)-3-bromo-2-[(Z)-3-bromopent-2-enyl]-5-chloro-6-[(E)-pent-2-en-4-ynyl]oxane | CAS Registry Number: 55306-12-2
Synonyms: Dactylyne, CID6441069, 3-Bromo-2-(3-bromo-2-pentenyl)-5-chlorotetrahydro-6-(2-penten-4-ynyl)-2H-pyran, 2H-Pyran, 3-bromo-2-(3-bromo-2-pentenyl)-5-chlorotetrahydro-6-(2-penten-4-ynyl)-, (2R-(2alpha(E),3alpha,5alpha,6alpha(Z)))-

Molecular Formula: C15H19Br2ClOMolecular Weight: 410.571760 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 1

InChIKey: NZHWXNQBZKBACG-MJYPMMBJSA-N

55306-12-2
DACURONIUM (5 suppliers)
Compound Structure IUPAC Name: [(3S,5S,10S,13S,17R)-17-hydroxy-10,13-dimethyl-2,16-bis(1-methylpiperidin-1-ium-1-yl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-3-yl] acetate | CAS Registry Number: 43021-45-0
Synonyms: Dacuronium, 17-Hydroxypancuronium, Androstane, piperidinium deriv., CID162536

Molecular Formula: C33H58N2O3+2Molecular Weight: 530.825220 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 3

InChIKey: XQFBAGUGBNQLRT-CSJYSYQFSA-N

43021-45-0
DACURONIUM BROMIDE (9 suppliers)
Compound Structure IUPAC Name: [(2S,3S,5S,10S,13S)-17-hydroxy-10,13-dimethyl-2,16-bis(1-methylpiperidin-1-ium-1-yl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-3-yl] acetate dibromide | CAS Registry Number: 27115-86-2
Synonyms: Dacuronium Bromide, Dacuronii bromidum, Bromuro de dacuronio, Bromure de dacuronium, Org 6368, NB68, Dacuronii bromidum [INN-Latin], Dacuronium bromide [BAN:INN], NB 68, Bromure de dacuronium [INN-French], Bromuro de dacuronio [INN-Spanish], EINECS 248-233-9, CID71705, UNII-33482245B6, LS-116477, 2-beta, 16-beta-Dipiperidino-5-alpha-androstan-3-alpha,17-beta-diol 3-acetate dimethobromide, 3-alpha-Acetoxy-2-beta,16-beta-dipiperidino-5-alpha-androstan-17-beta-ol dimethobromide, 5alpha-Androstan-3alpha,17beta-diol, 2beta,16beta-dipipecolinio-, dibromide, 3alpha-acetate, 1,1'-((2bea,3alpha,5alpha,16beta,17beta)-3-(Acetyloxy)-17-hydroxyandrostane-2,16-diyl)bis(1-methylperidinium)dibromide, Piperidinium, 1,1'-(2-beta,16-beta-(3-alpha,17-beta-dihydroxy-5-alpha-androstanylene))bis(1-methyl-, dibromide, 3-alpha-acetate

Molecular Formula: C33H58Br2N2O3Molecular Weight: 690.633220 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 5

InChIKey: SUKULMJPMHYWKC-ASCUVKKQSA-L

27115-86-2
Dadahol A (10 suppliers)
Compound Structure IUPAC Name: [(E)-3-[4-[(1S,2R)-1-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-[(E)-3-(4-hydroxyphenyl)prop-2-enoyl]oxypropan-2-yl]oxy-3,5-dimethoxyphenyl]prop-2-enyl] (E)-3-(4-hydroxyphenyl)prop-2-enoate | CAS Registry Number: 405281-76-7
Synonyms: MolPort-035-706-067, C39H38O12, ZINC49888876, W1843

Molecular Formula: C39H38O12Molecular Weight: 698.721 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 12

InChIKey: IKHAPHPJWABCCU-PQUVRFHRSA-N

405281-76-7
DADHP (3 suppliers)
Compound Structure IUPAC Name: 6,7-diphenyl-2,3-dihydro-1H-pyrrolizine | CAS Registry Number: 73009-82-2
Synonyms: CHEBI:334889, CID155766, 6,7-Diphenyl-2,3-dihydro-1H-pyrrolizine, 2,3-Dihydro-6,7-diphenyl-1H-pyrrolizine, 1H-Pyrrolizine, 2,3-dihydro-6,7-diphenyl-

Molecular Formula: C19H17NMolecular Weight: 259.344980 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 0

InChIKey: KTNZDKBUNJCAGR-UHFFFAOYSA-N

73009-82-2
DADMAC/AM Copolymer (0 suppliers)25590-05-6
Dadmac/Dmdaac (2 suppliers)7398-6-98
DADPS Biotin Alykne (3 suppliers)
Compound Structure IUPAC Name: 5-[(3aS,4S,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]-N-[2-[2-[2-[2-[3-[[2-methyl-2-[pent-4-ynoxy(diphenyl)silyl]oxypropyl]amino]-3-oxopropoxy]ethoxy]ethoxy]ethoxy]ethyl]pentanamide | CAS Registry Number: 2241685-22-1
Synonyms: Biotin-PEG4-amino-t-Bu-DADPS-C3-alykne, BP-24301, HY-140928, CS-0115872

Molecular Formula: C42H62N4O9SSiMolecular Weight: 827.100 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 10

InChIKey: DJUQDDBYPFLTPN-HKGQQODZSA-N

2241685-22-1
DADPS Biotin Azide (4 suppliers)1260247-50-4
DAECHUINE S 8-1 (2 suppliers)
Compound Structure Synonyms: Daechuine S8-1

Molecular Formula: C34H53N5O6Molecular Weight: 627.827 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 7

InChIKey: JNBWNLPBFQTODE-OWBHPGMISA-N

123089-23-6
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (0 suppliers)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG (0 suppliers)
DAEMONOROPS DRACO EXTRACT (5 suppliers)84776-31-8
DAF-2 (8 suppliers)
Compound Structure IUPAC Name: 5,6-diamino-3',6'-dihydroxyspiro[2-benzofuran-3,9'-xanthene]-1-one | CAS Registry Number: 205391-01-1
Synonyms: 4,5-Diaminofluorescein, SureCN8383527, CTK8F1067

Molecular Formula: C20H14N2O5Molecular Weight: 362.335560 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 7

InChIKey: LTYUPYUWXRTNFQ-UHFFFAOYSA-N

205391-01-1
DAF-2 DIACETATE (12 suppliers)
Compound Structure IUPAC Name: (6'-acetyloxy-5,6-diamino-3-oxospiro[2-benzofuran-1,9'-xanthene]-3'-yl) acetate | CAS Registry Number: 205391-02-2
Synonyms: 4,5-Diaminofluorescein diacetate, DAF-2 DA, 5,6-Diaminofluorescein diacetate, AC1O7FZ6, DAF-2 DA (cell permeable), 50277_FLUKA, 50277_SIGMA, CTK8E7129, (6'-acetyloxy-5,6-diamino-3-oxospiro[2-benzofuran-1,9'-xanthene]-3'-yl) acetate, 4,5-Diaminofluorescein diacetate-3',6'-bis(acetyloxy)-5,6-diamino-spiro[isobenzofuran-1(3H),9'-[9H]xanthen]-3-one

Molecular Formula: C24H18N2O7Molecular Weight: 446.408920 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 9

InChIKey: PTSUYDXEEKDBQU-UHFFFAOYSA-N

205391-02-2
DAF-2T (7 suppliers)
Compound Structure IUPAC Name: 3',6'-dihydroxyspiro[2H-furo[3,4-f]benzotriazole-7,9'-4a,9a-dihydroxanthene]-5-one | CAS Registry Number: 208850-35-5
Synonyms: CTK8F0991

Molecular Formula: C20H13N3O5Molecular Weight: 375.334320 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 7

InChIKey: OIFYZGJSZBYAJU-UHFFFAOYSA-N

208850-35-5
DAF-789 (2 suppliers)57657-08-6
Dafadine-A (9 suppliers)
Compound Structure IUPAC Name: [5-[(2,6-dimethylphenoxy)methyl]-1,2-oxazol-3-yl]-(4-pyridin-4-ylpiperidin-1-yl)methanone | CAS Registry Number: 1065506-69-5
Synonyms: CHEBI:88327, dafadine A, Ambcb24199950, MLS001090772, CHEMBL1585869, AOB1841, SYN5016, HMS2928H15, 3571AH, ZINC12373493, AKOS000365820, CS-3184, HY-16670, SMR000654704, KB-272050, {5-[(2,6-dimethylphenoxy)methyl]-1,2-oxazol-3-yl}[4-(pyridin-4-yl)piperidin-1-yl]methanone

Molecular Formula: C23H25N3O3Molecular Weight: 391.471 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 5

InChIKey: WNSNPYIHDMIFOO-UHFFFAOYSA-N

1065506-69-5
daffodil flower water (0 suppliers)90064-27-0
Daflon (2 suppliers)
Compound Structure IUPAC Name: 5-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-7-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxymethyl]oxan-2-yl]oxychromen-4-one;(2S)-5-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-7-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxymethyl]oxan-2-yl]oxy-2,3-dihydrochromen-4-one | CAS Registry Number: 111804-73-0
Synonyms: Capiven, Detralex, Venitol, Arvenum 500, S5682, S 5682, S-5682

Molecular Formula: C56H66O30Molecular Weight: 1219.105240 [g/mol]
H-Bond Donor: 16H-Bond Acceptor: 30

InChIKey: UPZXYHXBFVZRHQ-RSZBNIDCSA-N

111804-73-0
DAG-OIL (2 suppliers)308082-33-9
DAGA PROTEIN,ALTEROMONAS HALOPLANKTIS (2 suppliers)148349-99-9
DAGAPAMIL (5 suppliers)
Compound Structure IUPAC Name: 2-[3-[2-(3-methoxyphenyl)ethyl-methylamino]propyl]-2-(3,4,5-trimethoxyphenyl)tetradecanenitrile | CAS Registry Number: 85247-76-3
Synonyms: Dagapamil, Dagapamilum, Dagapamil [INN], UNII-64O87U613H, CID205957

Molecular Formula: C36H56N2O4Molecular Weight: 580.840840 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 6

InChIKey: BGCVNLXQFOHWMO-UHFFFAOYSA-N

85247-76-3
Dagapamil hydrochloride (1 supplier)
Compound Structure IUPAC Name: 2-[3-[2-(3-methoxyphenyl)ethyl-methylamino]propyl]-2-(3,4,5-trimethoxyphenyl)tetradecanenitrile;hydrochloride | CAS Registry Number: 85246-70-4
Synonyms: Benzeneacetonitrile, alpha-dodecyl-3,4,5-trimethoxy-alpha-(3-((2-(3-methoxyphenyl)ethyl)methylamino)propyl)-, hydrochloride (1:1), Benzeneacetonitrile, alpha-dodecyl-3,4,5-trimethoxy-alpha-(3-((2-(3-methoxyphenyl)ethyl)methylamino)propyl)-, monohydrochloride, Q27260530, 2-[3-[2-(3-methoxyphenyl)ethyl-methylamino]propyl]-2-(3,4,5-trimethoxyphenyl)tetradecanenitrile;hydrochloride

Molecular Formula: C36H57ClN2O4Molecular Weight: 617.300 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 6

InChIKey: UFADIJNJESEOGE-UHFFFAOYSA-N

85246-70-4
DAGL▀-IN-1 (2 suppliers)
Compound Structure IUPAC Name: tert-butyl N-[5-[2-phenylethyl-[4-[4-(trifluoromethoxy)phenyl]triazole-1-carbonyl]amino]pentyl]carbamate | CAS Registry Number: 1402612-61-6
Synonyms: CarbaMic acid, N-[5-[(2-phenylethyl)[[4-[4-(trifluoroMethoxy)phenyl]-1H-1,2,3-triazol-1-yl]carbonyl]aMino]pentyl]-, 1,1-diMethylethyl ester, tert-Butyl (5-(N-phenethyl-4-(4-(trifluoromethoxy)phenyl)-1H-1,2,3-triazole-1-carboxamido)pentyl)carbamate, DAGL|A-IN-1, MLS004256811, SCHEMBL13192907, HY-18551, SMR003081886, CS-0008171, SR-02000002085, SR-02000002085-1, CarbaMic acid,N-[5-[(2-phenylethyl)[[4-[4-(trifluoroMethoxy)phenyl]-1H-1,2,3-triazol-1-yl]carbonyl]aMino]pentyl]-,1,1-diMethylethyl ester

Molecular Formula: C28H34F3N5O4Molecular Weight: 561.600 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 9

InChIKey: NUWWTGPNHRKNPN-UHFFFAOYSA-N

1402612-61-6
6751 to 6800 of 41252 results  Page: << Previous 50 Results 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 [136] 137 138 139 140 >> Next 50 Results
Alphabetical Products   |   ALL 20,000 Suppliers
HomeBuyAdd FREE ListingAdvertise Chemical Company