A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  1  2  3  4  5  *
CHEMICAL products beginning with : A
33601 to 33650 of 54389 results  Page: << Previous 50 Results 660 661 662 663 664 665 666 667 668 669 670 671 672 [673] 674 675 676 677 678 679 680 >> Next 50 Results
 PRODUCT NAMECAS Registry Number 
AI 335467AGA (6 suppliers)
Compound Structure IUPAC Name: 1-pyrrolidin-1-ylbutan-1-one | CAS Registry Number: 33527-93-4
Synonyms: Pyrrolidine, 1-butyryl-, Pyrrolidine, 1-(1-oxobutyl)-, AI 335467aGa, NSC191001, CID303117

Molecular Formula: C8H15NOMolecular Weight: 141.210800 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 1

InChIKey: QEAWNPFOQLJDAY-UHFFFAOYSA-N

33527-93-4
AI 77C (0 suppliers)77675-00-4
AI 77G (2 suppliers)77675-03-7
AI-10-49 (13 suppliers)
Compound Structure IUPAC Name: 6-(trifluoromethoxy)-2-[5-[2-[2-[6-[6-(trifluoromethoxy)-1H-benzimidazol-2-yl]pyridin-3-yl]oxyethoxy]ethoxy]pyridin-2-yl]-1H-benzimidazole | CAS Registry Number: 1256094-72-0
Synonyms: SCHEMBL179114, EX-A597, MolPort-039-193-835, AKOS030526362, ZINC164460208, DA-46659, HY-16786, J-690106, 2,2'-(5,5'-((oxybis(ethane-2,1-diyl))bis(oxy))bis(pyridine-5,2-diyl))bis(6-(trifluoromethoxy)-1H-benzo[d]imidazole), 6-(trifluoromethoxy)-2-(5-{2-[2-({6-[6-(trifluoromethoxy)-1H-1,3-benzodiazol-2-yl]pyridin-3-yl}oxy)ethoxy]ethoxy}pyridin-2-yl)-1H-1,3-benzodiazole

Molecular Formula: C30H22F6N6O5Molecular Weight: 660.533 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 15

InChIKey: WJBSSBFGPKTMQQ-UHFFFAOYSA-N

1256094-72-0
Ai-346/37349002 (1 supplier)
Compound Structure Synonyms: AI-346/37349002, BAS 02098998, AC1MEWM0, CBMicro_019158, Oprea1_191397, Oprea1_582816, STOCK1S-93845, MolPort-000-733-870, MolPort-019-707-085, CCG-13864, STL058938, AKOS000669980, AKOS022008788, AKOS025261839, MCULE-3945411338, BIM-0019181.P001, EU-0005851, 3-{4-nitrophenyl}-4-propionyl-1,4,5-triazatricyclo[5.2.2.0~2,6~]undec-5-ene, 1-[3-(4-nitrophenyl)-3,3a,6,7-tetrahydro-4,7-ethanopyrazolo[4,3-b]pyridin-2(5H)-yl]propan-1-one

Molecular Formula: C17H20N4O3Molecular Weight: 328.365700 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 5

InChIKey: SUQLDIGMLLWLIT-UHFFFAOYSA-N

6087-61-2
AI-77-B (6 suppliers)
Compound Structure IUPAC Name: (3S,4S,5S)-3-amino-4,5-dihydroxy-6-[[(1S)-1-[(3S)-8-hydroxy-1-oxo-3,4-dihydroisochromen-3-yl]-3-methylbutyl]amino]-6-oxohexanoic acid | CAS Registry Number: 77674-99-8
Synonyms: AI 77B, BRN 4338357, CID197216, LS-75520, Hexar-1-amic acid, 4-amino-4,5-dideoxy-N-(1-(3,4-dihydro-8-hydroxy-1-oxo- 1H-2-benzopyran-3-yl)-3-methylbutyl)-

Molecular Formula: C20H28N2O8Molecular Weight: 424.444920 [g/mol]
H-Bond Donor: 6H-Bond Acceptor: 9

InChIKey: LOXFXXGTOVWWQV-YKRRISCLSA-N

77674-99-8
AI3-20685GC (3 suppliers)87805-44-5
AI3-37220; 1-(3-CYCLOHEXEN-1-YLCARBONYL)-2-METHYLPIPERIDINE (14 suppliers)
Compound Structure IUPAC Name: cyclohex-3-en-1-yl-(2-methylpiperidin-1-yl)methanone | CAS Registry Number: 69462-43-7
Synonyms: MolPort-003-987-757, CID90567, AI3 37220, AI3-37220, 1-(3-Cyclohexen-1-ylcarbonyl)-2-methylpiperidine, LS-15399, TL8006600, I14-6708, T6213802, Piperidine, 1-(3-cyclohexen-1-ylcarbonyl)-2-methyl-, Piperidine, 1-(3-cyclohexen-1-ylcarbonyl)-2-methyl- (9CI), 77251-47-9

Molecular Formula: C13H21NOMolecular Weight: 207.311940 [g/mol]
H-Bond Donor: 0H-Bond Acceptor: 1

InChIKey: KRHYGGFLEBNTHQ-UHFFFAOYSA-N

69462-43-7
AIAP, >97% (8 suppliers)
Compound Structure IUPAC Name: (2S)-2-amino-5-[(2-iodoacetyl)amino]pentanoic acid | CAS Registry Number: 35748-65-3
Synonyms: 2-AIHA, L-Ornithine, N5-(iodoacetyl)-, L-Ornithine, N(sup 5)-(iodoacetyl)-, N(sup 5)-(Iodoacetyl)-L-ornithine, 2-Amino-5-iodoacetamidopentanoic acid, CID160253, (+)-S-2-Amino-6-iodoacetamidohexanoic acid, LS-98411

Molecular Formula: C7H13IN2O3Molecular Weight: 300.094190 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 4

InChIKey: ZDWGLSKCVZNFLT-YFKPBYRVSA-N

35748-65-3
AIBELLIN (5 suppliers)
Compound Structure Synonyms: Aibellin

Molecular Formula: C94H147N21O27Molecular Weight: 2003.330 [g/mol]
H-Bond Donor: 24H-Bond Acceptor: 47

InChIKey: LPLUASOETQZGDI-OHGRIBQFSA-N

151036-29-2
AIC2A PROTEIN (5 suppliers)144715-96-8
AIC2B PROTEIN (5 suppliers)144715-98-0
AICAMINE (2 suppliers)7425-69-6
AICAR (PHOSPHATE), 98% (6 suppliers)
Compound Structure IUPAC Name: 5-amino-1-[(2R,3S,5R)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]imidazole-4-carboxamide;phosphoric acid | CAS Registry Number: 681006-28-0
Synonyms: AICAR phosphate, AICA Riboside phosphate, HY-13417A, CS-1952

Molecular Formula: C9H17N4O9PMolecular Weight: 356.226442 [g/mol]
H-Bond Donor: 8H-Bond Acceptor: 11

InChIKey: BPVGMEHURDEDAZ-CODPYOKSSA-N

681006-28-0
AICAR 3':5'-MONOPHOSPHATE (10 suppliers)
Compound Structure IUPAC Name: 5-amino-1-(2,7-dihydroxy-2-oxo-4a,6,7,7a-tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl)imidazole-4-carboxamide | CAS Registry Number: 35908-14-6
Synonyms: NSC371796, CID340730

Molecular Formula: C9H13N4O7PMolecular Weight: 320.195881 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 9

InChIKey: QQDWJBYNAORJHB-UHFFFAOYSA-N

35908-14-6
AICAR DIPHOSPHATE, SODIUM SALT (7 suppliers)102185-54-6
AIDA PROTEIN (5 suppliers)141442-92-4
Aids-044870 (1 supplier)
Compound Structure IUPAC Name: 4-methyl-N-(4-methylphenyl)benzenecarbothioamide | CAS Registry Number: 53724-39-3
Synonyms: p-Tolu-p-toluidide, thio-, Benzenecarbothioamide, 4-methyl-N-(4-methylphenyl)-, AC1MHDQS, 4-methyl-N-(p-tolyl)benzenecarbothioamide, N-(4-Methylphenyl)-4-methylthiobenzamide, 4-methyl-N-(4-methylphenyl)benzenecarbothioamide

Molecular Formula: C15H15NSMolecular Weight: 241.351300 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 1

InChIKey: IDZZSCUIBLBWQW-UHFFFAOYSA-N

53724-39-3
Ailamode (33 suppliers)
Compound Structure IUPAC Name: N-[7-(methanesulfonamido)-4-oxo-6-phenoxychromen-3-yl]formamide | CAS Registry Number: 123663-49-0
Synonyms: Iguratimod, Careram, Colvet, Kolbet, Iguratimod [INN], Iguratimod (JAN/INN), CID124246, NCGC00181783-01, T-614, T 614, D01146, 3-Formylamino-7-methylsulfonylamino-6-phenoxy-4H-1-benzopyran-4-one, Methanesulfonamide, N-(3-(formylamino)-4-oxo-6-phenoxy-4H-1-benzopyran-7-yl)-

Molecular Formula: C17H14N2O6SMolecular Weight: 374.367860 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 7

InChIKey: ANMATWQYLIFGOK-UHFFFAOYSA-N

123663-49-0
AILANQUASSIN B (2 suppliers)
Compound Structure Synonyms: Samaderine Y, (-)-samaderine Y, (1beta,11beta,12alpha)-1,11,12-Trihydroxy-13,20-epoxypicras-3-ene-2,16-dione, CHEBI:66163

Molecular Formula: C20H26O7Molecular Weight: 378.421 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 7

InChIKey: RIJRPXOHKGHZPR-SEAJDPHJSA-N

159903-53-4
AILANTHOL (2 suppliers)96304-93-7
AILANTHONE (19 suppliers)
Compound Structure Synonyms: Ailanthone, Ailantone, Ailanthone (7CI), CHEBI:368899, AIDS026407, AIDS-026407, CID72965, LS-64078, C08747, 2H-1,11c-(Epoxymethano)phenanthro(10,1-bc)pyran-5,10(3H,6ah)-dione, 1,3a,4,7,7a,11,11a,11b-octahydro-8,11a-beta-dimethyl-3-methylene-1-alpha,2-beta,11-beta-trihydroxy-, Picrasa-3,13(21)-diene-2,16-dione, 11,20-epoxy-1,11,12-trihydroxy-, (1-beta,11-beta,12-alpha)-, Picrasa-3,13(21)-diene-2,16-dione, 11,20-epoxy-1,11,12-trihydroxy-, (1beta,11beta,12alpha)-, Picrasa-3,13(21)-dien-2,16-dione, 11,20-epoxy-1,11,12-trihydroxy-, (1.beta.,11.beta.,12.alpha.)

Molecular Formula: C20H24O7Molecular Weight: 376.400360 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 7

InChIKey: WBBVXGHSWZIJST-RLQYZCPESA-N

981-15-7
AILANTHUS EXCELSA,EXT (3 suppliers)92201-14-4
AIM-100, 98% (12 suppliers)
Compound Structure IUPAC Name: N-[[(2S)-oxolan-2-yl]methyl]-5,6-diphenylfuro[2,3-d]pyrimidin-4-amine | CAS Registry Number: 873305-35-2
Synonyms: AIM-100, AIM100, CHEMBL247070, MLS006010340, SCHEMBL2965872, CHEMBL3186838, MolPort-035-765-893, AKOS024458428, CS-0702, NCGC00347279-01, HY-15290, SMR004701402, W-5920, 5,6-Diphenyl-N-[[(2S)-tetrahydro-2-furanyl]methyl]furo[2,3-d]pyrimidin-4-amine

Molecular Formula: C23H21N3O2Molecular Weight: 371.431740 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 5

InChIKey: XNFHHOXCDUAYSR-SFHVURJKSA-N

873305-35-2
AINSLIASIDE B (2 suppliers)93303-17-4
AINSLIOSIDE (2 suppliers)84294-92-8
AIPOLIC ACID (3 suppliers)125304-74-7
AIPP-EM (8 suppliers)
Compound Structure IUPAC Name: [(8R,9S,13S,14S,17S)-17-[2-[3-(4-azido-3-iodanylphenyl)propanoylamino]ethylcarbamoyloxy]-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] N,N-bis(2-chloroethyl)carbamate | CAS Registry Number: 159899-37-3
Synonyms: Aipp-EM, CID157834, 17-O-((2-(3-(4-Azido-3-iodophenyl)propionamido)ethyl)carbamyl)estradiol-3-N-bis(chloroethyl)carbamate, Estra-1,3,5(10)-triene-3,17-diol (17beta)-, 17-((2-((3-(4-azido-3-(iodo-125I)phenyl)-1-oxopropyl)amino)ethyl)carbamate) 3-(bis(2-chloroethyl)caramate)

Molecular Formula: C35H43Cl2IN6O5Molecular Weight: 823.563744 [g/mol]
H-Bond Donor: 2H-Bond Acceptor: 7

InChIKey: YYDIMLLAANCLAT-SMLQHYSKSA-N

159899-37-3
AIR CONDITION HOSE FOR HELICOPTER (0 suppliers)
Air Desiccator HF-404B For Automobile (0 suppliers)
Air Entraining Agents (2 suppliers)
AIR FRESHENER (2 suppliers)50-14-1
Air Fresheners (14 suppliers)
Air Treatment Chemicals (0 suppliers)
Aircraft Chemicals (0 suppliers)
Aircraft Hydraulic Fluid (1 supplier)
AIRODENT-02 (6 suppliers)114691-27-9
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD (0 suppliers)
Aiye Leaf Extract (3 suppliers)
AIZEN CATHILON RED GLH (3 suppliers)12221-62-4
AIZEN CATHILON VIOLET FRLH (3 suppliers)12221-71-5
AIZEN CATHILON YELLOW T-RLH (2 suppliers)135151-48-3
Aizen Opal Black New (0 suppliers)85854-35-9
AIZEN RHODAMINE 6GCP BASE (2 suppliers)
Compound Structure IUPAC Name: ethyl 2-[3-(ethylamino)-6-ethylimino-2,7-dimethylxanthen-9-yl]benzoate | CAS Registry Number: 3373-01-1
Synonyms: RHODAMINE 6G, Rhodanine 6GDN, Rhodamine 6 G extra, Aizen Rhodamine 6GCP, C.I. 45160, CHEMBL402140, NSC10474, NSC36345, NSC47732, Xanthylium, 9-[2-(ethoxycarbonyl)phenyl]-3,6-bis(ethylamino)-2,7-dimethyl-, chloride, 989-38-8, Rhodamine 6G base, Rhodamine 490, Rhodamine 6G- parent, CBChromo1_000143, AC1L22IZ, Aizen Rhodamine 6GCP Base, CBDivE_013147, SCHEMBL1495836, SCHEMBL4817749

Molecular Formula: C28H30N2O3Molecular Weight: 442.559 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 5

InChIKey: IWWWBRIIGAXLCJ-UHFFFAOYSA-N

3373-01-1
Aizen Spilon Pink BH (0 suppliers)60650-24-0
AIZEN SPILON RED GEH (2 suppliers)39290-76-1
AJACINE (6 suppliers)
Compound Structure Synonyms: Ajacine, Pontaconitine A, N-(Acetylanthraniloyl)lycoctonine, CID3083604, 1353-86-2, Aconitane-7,8-diol, 4-(((2-(acetylamino)benzoyl)oxy)methyl)-20-ethyl-1,6,14,16-tetramethoxy-, (1alpha,6beta,14alpha,16eta)-

Molecular Formula: C34H48N2O9Molecular Weight: 628.752920 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 10

InChIKey: NUXFDCYXMLVOFU-KJWLPSOCSA-N

509-17-1
AJADIN (4 suppliers)
Compound Structure Synonyms: Ajadin

Molecular Formula: C15H18O4Molecular Weight: 262.305 [g/mol]
H-Bond Donor: 1H-Bond Acceptor: 4

InChIKey: CUEXORQHTMDQIA-CSWWBCRBSA-N

72980-08-6
AJAFIN (2 suppliers)86925-82-8
AJICURE MY 24 (5 suppliers)134091-75-1
33601 to 33650 of 54389 results  Page: << Previous 50 Results 660 661 662 663 664 665 666 667 668 669 670 671 672 [673] 674 675 676 677 678 679 680 >> Next 50 Results
Alphabetical Products   |   ALL 20,000 Suppliers
HomeBuyAdd FREE ListingAdvertise Chemical Company