Skype
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  1  2  3  4  5  *
CHEMICAL products beginning with : H
501 to 550 of 23200 results  Page: << Previous 50 Results 1 2 3 4 5 6 7 8 9 10 [11] 12 13 14 15 16 17 18 19 20 >> Next 50 Results
 PRODUCT NAMECAS Registry Number 
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET(O)-VAL-GLY-GLY-VAL-VAL-OH (1 supplier)178302-50-6
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET(O2)-VAL-GLY-GLY-VAL-VAL-ILE-ALA-OH (1 supplier)1802086-69-6
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-OH (2 suppliers)115427-62-8
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH (5 suppliers)
Compound Structure Synonyms: Amyloid beta-Protein (1-46)

Molecular Formula: C223H347N59O65SMolecular Weight: 4926.637 [g/mol]
H-Bond Donor: 67H-Bond Acceptor: 73

InChIKey: TYTBZPLKUQHHLH-BQISHUBISA-N

285554-31-6
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-NH2 (2 suppliers)203460-31-5
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-OH (3 suppliers)
Compound Structure Synonyms: Amyloid ?-Peptide (1-37) (human)

Molecular Formula: C182H274N50O55SMolecular Weight: 4074.000 [g/mol]
H-Bond Donor: 57H-Bond Acceptor: 63

InChIKey: LKNGNRVBKQEJPA-IUMSEVKGSA-N

186359-67-1
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-NLE-VAL-GLY-GLY-VAL-VAL-ILE-ALA-OH (2 suppliers)1802086-51-6
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-NLE-VAL-GLY-GLY-VAL-VAL-OH (1 supplier)1802086-31-2
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-VAL-MET-VAL-GLY-GLY-VAL-VAL-OH (3 suppliers)1678415-83-2
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-OH (3 suppliers)
Compound Structure IUPAC Name: (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-carboxy-1-[[(2S)-3-carboxy-1-[[(1S)-1-carboxy-2-methylpropyl]amino]-1-oxopropan-2-yl]amino]-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]propanoyl]amino]-5-oxopentanoic acid;2,2,2-trifluoroacetic acid | CAS Registry Number: 138648-77-8
Synonyms: Amyloid b-Protein (1-24) Trifluoroacetate@CRLF138648-77-8

Molecular Formula: C132H184F3N35O42Molecular Weight: 2990.100 [g/mol]
H-Bond Donor: 42H-Bond Acceptor: 51

InChIKey: IOSMGZSYCCGPRW-DPTLEDCXSA-N

138648-77-8
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLY-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-OH (4 suppliers)1802086-23-2
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-OH (7 suppliers)
Compound Structure Synonyms: Amyloid b-Protein (1-16)

Molecular Formula: C84H119N27O28Molecular Weight: 1955.037 [g/mol]
H-Bond Donor: 31H-Bond Acceptor: 34

InChIKey: PKSRFXGDLPWBBS-GXMMQULOSA-N

131580-10-4
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-OH (6 suppliers)
Compound Structure Synonyms: Amyloid |A-Protein (1-15)

Molecular Formula: C78H107N25O27Molecular Weight: 1826.835480 [g/mol]
H-Bond Donor: 29H-Bond Acceptor: 32

InChIKey: CSCAPVBQOYQJJF-NOZGEEMHSA-N

183745-81-5
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-OH TRIFLUOROACETATE (2 suppliers)
Compound Structure IUPAC Name: (4S)-4-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]propanoyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-4-carboxy-1-[[(1S)-1-carboxy-2-methylpropyl]amino]-1-oxobutan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-oxopentanoic acid;2,2,2-trifluoroacetic acid | CAS Registry Number: 142047-91-4
Synonyms: Amyloid b-Protein (1-12) Trifluoroacetate

Molecular Formula: C63H86F3N17O25Molecular Weight: 1538.500 [g/mol]
H-Bond Donor: 23H-Bond Acceptor: 31

InChIKey: SINJZDBTBHYMDB-YKAPFYSSSA-N

142047-91-4
H-ASP-ALA-HIS-LYS-OH (10 suppliers)
Compound Structure IUPAC Name: (2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]propanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]hexanoic acid | CAS Registry Number: 111543-77-2
Synonyms: ZINC3917694, AKOS030622996

Molecular Formula: C19H31N7O7Molecular Weight: 469.499 [g/mol]
H-Bond Donor: 8H-Bond Acceptor: 10

InChIKey: LNDPHUOSLCCHHY-PYJNHQTQSA-N

111543-77-2
H-ASP-ALA-OH (10 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-hydroxy-1-oxopropan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 13433-02-8
Synonyms: alpha-Asp-ala, alpha-Aspartylalanine, N-L-alpha-Aspartyl-L-alanine, STOCK1N-53975, CHEBI:119870, MolPort-002-527-031, CID5491963, 3-Amino-N-((S)-1-carboxy-ethyl)-succinamic acid, (S)-3-Amino-N-((S)-1-carboxy-ethyl)-succinamic acid

Molecular Formula: C7H12N2O5Molecular Weight: 204.180580 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 6

InChIKey: DVUFTQLHHHJEMK-IMJSIDKUSA-N

13433-02-8
H-ASP-ALA-PRO-ALA-ALA-PRO-ALA-GLY-PRO-ALA-VAL-PRO-VAL-OH (3 suppliers)339990-32-8
H-ASP-ALA-SER-PHE-HIS-SER-TRP-GLY-NH2 (2 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[(2-amino-2-oxoethyl)amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 104958-72-7
Synonyms: Leucokinin IV

Molecular Formula: C41H52N12O12Molecular Weight: 904.939 [g/mol]
H-Bond Donor: 14H-Bond Acceptor: 14

InChIKey: CEJTUUCZPGQQRP-PDJARTMPSA-N

104958-72-7
H-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2 (6 suppliers)
Compound Structure Synonyms: VZHGFXMUWRDKMY-GNASPNIESA-N, VIP (3-28) (human, mouse, rat)

Molecular Formula: C138H226N40O39SMolecular Weight: 3101.627 [g/mol]
H-Bond Donor: 47H-Bond Acceptor: 46

InChIKey: VZHGFXMUWRDKMY-GNASPNIESA-N

115444-33-2
H-ASP-AMC (5 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[(4-methyl-2-oxochromen-7-yl)amino]-4-oxobutanoic acid | CAS Registry Number: 219138-13-3
Synonyms: L-Asp-AMC, L-D-AMC, L-Asp-7-Amino-4-Methylcoumarin, H-Asp-AMC, AC1MC035, CTK8F0642, (3S)-3-amino-4-[(4-methyl-2-oxochromen-7-yl)amino]-4-oxobutanoic acid

Molecular Formula: C14H14N2O5Molecular Weight: 290.271360 [g/mol]
H-Bond Donor: 3H-Bond Acceptor: 6

InChIKey: AAGPGZSFBVEQMU-JTQLQIEISA-N

219138-13-3
H-Asp-Arg-Asn-Phe-Leu-Arg-Phe-NH2 (3 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 149471-11-4
Synonyms: Drnflrfamide, Neuropeptide DF2, DF(2) Neuropeptide, AC1L31R0, Asp-arg-asn-phe-leu-arg-phe-NH2, Aspartyl-arginyl-asparaginyl-phenylalanyl-leucyl-arginyl-phenylalaninamide, (3S)-3-amino-4-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid, L-alpha-Aspartyl-L-arginyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide, L-Phenylalaninamide, L-alpha-aspartyl-L-arginyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-arginyl-

Molecular Formula: C44H67N15O10Molecular Weight: 966.097280 [g/mol]
H-Bond Donor: 14H-Bond Acceptor: 13

InChIKey: DWSQPUHNGRSXSJ-MRNVWEPHSA-N

149471-11-4
H-ASP-ARG-BNA (5 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-5-(diaminomethylideneamino)-1-(naphthalen-2-ylamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 51528-58-6
Synonyms: H-Asp-Arg-betaNA, H-Asp-Arg-Beta-Na, AC1OLQZW, ZINC4899556, C-56716, (3S)-3-amino-4-[[(2S)-5-(diaminomethylideneamino)-1-(naphthalen-2-ylamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid

Molecular Formula: C20H26N6O4Molecular Weight: 414.466 [g/mol]
H-Bond Donor: 6H-Bond Acceptor: 6

InChIKey: QSTDLELXKRKTHT-HOTGVXAUSA-N

51528-58-6
H-Asp-Arg-Gly-Asp-Ser-OH (3 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[2-[[(2S)-3-carboxy-1-[[(1S)-1-carboxy-2-hydroxyethyl]amino]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 151997-53-4
Synonyms: ZINC59191457

Molecular Formula: C19H32N8O11Molecular Weight: 548.510 [g/mol]
H-Bond Donor: 11H-Bond Acceptor: 13

InChIKey: VXYAWCJCNZVGPR-NAKRPEOUSA-N

151997-53-4
H-ASP-ARG-LEU-ASP-SER-OH (5 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[1-[[(2S)-3-carboxy-1-[[(1S)-1-carboxy-2-hydroxyethyl]amino]-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 145880-23-5
Synonyms: DRLDS

Molecular Formula: C23H40N8O11Molecular Weight: 604.610700 [g/mol]
H-Bond Donor: 11H-Bond Acceptor: 13

InChIKey: WSLUAFITKPPCRS-CMTGQMGJSA-N

145880-23-5
H-Asp-Arg-OH (2 suppliers)2640-07-5
H-ASP-ARG-VAL-TYR-ILE-HIS-D-ALA-OH (10 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(1R)-1-carboxyethyl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 159432-28-7
Synonyms: A 779, (D-Ala7)-Angiotensin I/II (1-7), A-779, Ang(1-7) D-Ala7, BDBM85554, HY-P0216, AKOS027470317, ZINC169692712, J-009603

Molecular Formula: C39H60N12O11Molecular Weight: 872.982 [g/mol]
H-Bond Donor: 13H-Bond Acceptor: 14

InChIKey: GZSZZUXDAPDPOR-NGIFJXEWSA-N

159432-28-7
H-ASP-ARG-VAL-TYR-ILE-HIS-D-PRO-OH (4 suppliers)
Compound Structure IUPAC Name: (2R)-1-[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-methylpentanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carboxylic acid | CAS Registry Number: 586962-44-9
Synonyms: (D-Pro7)-Angiotensin I/II (1-7), CHEMBL2369553, ZINC169296914, FT-0771652

Molecular Formula: C41H62N12O11Molecular Weight: 899.020 [g/mol]
H-Bond Donor: 12H-Bond Acceptor: 14

InChIKey: PVHLMTREZMEJCG-SMAUMWCNSA-N

586962-44-9
H-ASP-ARG-VAL-TYR-ILE-HIS-PRO-[RING-D5]PHE-OH (2 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[(2S)-2-[[(1S)-1-carboxy-2-(2,3,4,5,6-pentadeuteriophenyl)ethyl]carbamoyl]pyrrolidin-1-yl]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 1926163-73-6
Synonyms: MFCD18643375

Molecular Formula: C50H71N13O12Molecular Weight: 1051.200 [g/mol]
H-Bond Donor: 13H-Bond Acceptor: 15

InChIKey: CZGUSIXMZVURDU-LFAVMEPXSA-N

1926163-73-6
H-ASP-ARG-VAL-TYR-ILE-HIS-PRO-PHE-HIS-LEU-LEU-TYR- (7 suppliers)
Compound Structure Synonyms: ANGIOTENSINOGEN (1-14) (RAT), FT-0688971

Molecular Formula: C89H123N21O21Molecular Weight: 1823.089 [g/mol]
H-Bond Donor: 24H-Bond Acceptor: 25

InChIKey: FFCYBSGRCYFCNM-YXRWNMRVSA-N

110200-37-8
H-ASP-ARG-VAL-TYR-ILE-HIS-PRO-PHE-HIS-LEU-VAL-ILE- (9 suppliers)
Compound Structure Synonyms: Preangiotensinogen 1-14, Renin Substrate Tetradecapeptide, ANGIOTENSINOGEN, Fragment 1-14, Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn

Molecular Formula: C83H122N24O19Molecular Weight: 1760.006180 [g/mol]
H-Bond Donor: 23H-Bond Acceptor: 26

InChIKey: UYYRANYWSOXAEK-UHFFFAOYSA-N

104180-23-6
H-ASP-ARG-VAL-TYR-ILE-HIS-PRO-PHE-HIS-LEU-VAL-ILE-HIS-SER-OH (6 suppliers)
Compound Structure Synonyms: SHAT, Serine human angiotensin tetradecapeptide, H-Asp-arg-val-tyr-ile-his-pro-phe-his-leu-val-ile-ser-OH, Angiotensinogen, 5-L-isoleucine-11-L-valine-12-L-isoleucine-13-L-histidine-, (3alpha,5beta,7alpha,12alpha)-, H-Asparaginyl-arginyl-valyl-tyrosyl-isoleucyl-histyl-prolyl-phenylalanyl-histyl-leucyl-valyl-isoleucyl-serine

Molecular Formula: C82H121N23O19Molecular Weight: 1732.980840 [g/mol]
H-Bond Donor: 23H-Bond Acceptor: 26

InChIKey: CQGAGLNDCXHGEL-SDDIQEGKSA-N

91999-74-5
H-ASP-ARG-VAL-TYR-ILE-HIS-PRO-PHE-HIS-LEU-VAL-ILE-OH (6 suppliers)
Compound Structure IUPAC Name: (2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-methylpentanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carbonyl]amino]-3-phenylpropanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-4-methylpentanoyl]amino]-3-methylbutanoyl]amino]-3-methylpentanoic acid | CAS Registry Number: 136865-09-3
Synonyms: Angiotensin (1-12) (human)

Molecular Formula: C73H109N19O16Molecular Weight: 1508.792 [g/mol]
H-Bond Donor: 18H-Bond Acceptor: 20

InChIKey: HUIMDLALQQGEEN-ZOXCJXDUSA-N

136865-09-3
H-ASP-ASN-GLN-OH (3 suppliers)
Compound Structure IUPAC Name: (2S)-5-amino-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-4-oxobutanoyl]amino]-5-oxopentanoic acid | CAS Registry Number: 286465-87-0
Synonyms: H-Asp-Asn-Gln-OH, ZINC15721859

Molecular Formula: C13H21N5O8Molecular Weight: 375.338 [g/mol]
H-Bond Donor: 7H-Bond Acceptor: 9

InChIKey: ATYWBXGNXZYZGI-ACZMJKKPSA-N

286465-87-0
H-ASP-ASN-ILE-LYS-HIS-VAL-PRO-GLY-GLY-GLY-SER-VAL-GLN-ILE-VAL-OH (2 suppliers)
Compound Structure IUPAC Name: (2S)-2-[[(2S,3S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[2-[[2-[[2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S,3S)-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-4-oxobutanoyl]amino]-3-methylpentanoyl]amino]hexanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-3-methylbutanoyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]amino]-3-methylbutanoic acid;2,2,2-trifluoroacetic acid | CAS Registry Number: 330456-46-7
Synonyms: Tau Peptide (295-309) Trifluoroacetate

Molecular Formula: C68H111F3N20O23Molecular Weight: 1633.700 [g/mol]
H-Bond Donor: 22H-Bond Acceptor: 29

InChIKey: ICHNUMSCRNWGRS-ILWNQBCHSA-N

330456-46-7
H-ASP-ASP-ALA-VAL-TYR-LEU-ASP-ASN-GLU-LYS-GLU-ARG-GLU-GLU-TYR-VAL-LEU-ASN-ASP-ILE-GLY-VAL-ILE-PHE-TYR-GLY-GLU-VAL-ASN-ASP-ILE-LYS-THR-ARG-SER-TRP-SER-TYR-GLY-GLN-PHE-OH (5 suppliers)158455-48-2
H-ASP-ASP-ASP-ASP-OH (8 suppliers)
Compound Structure IUPAC Name: 2-[[2-[[2-[(2-amino-3-carboxypropanoyl)amino]-3-carboxypropanoyl]amino]-3-carboxypropanoyl]amino]butanedioic acid | CAS Registry Number: 145224-95-9
Synonyms: Asp-Asp-Asp-Asp, AC1NASIL, A4440_SIGMA, 2-[[2-[[2-[(2-amino-4-hydroxy-4-oxobutanoyl)amino]-4-hydroxy-4-oxobutanoyl]amino]-4-hydroxy-4-oxobutanoyl]amino]butanedioic acid

Molecular Formula: C16H22N4O13Molecular Weight: 478.364880 [g/mol]
H-Bond Donor: 9H-Bond Acceptor: 14

InChIKey: OZRFYUJEXYKQDV-UHFFFAOYSA-N

145224-95-9
H-ASP-ASP-ASP-OH (7 suppliers)
Compound Structure IUPAC Name: (2S)-2-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-3-carboxypropanoyl]amino]butanedioic acid | CAS Registry Number: 107208-63-9
Synonyms: Asp-Asp-Asp-OH, H-Asp-Asp-Asp-OH, SCHEMBL434311, CHEMBL276531, ZINC4533843, AKOS030622999, AM005900, (2S)-2-[(2S)-2-[(2S)-2-AMINO-3-CARBOXYPROPANAMIDO]-3-CARBOXYPROPANAMIDO]BUTANEDIOIC ACID

Molecular Formula: C12H17N3O10Molecular Weight: 363.279 [g/mol]
H-Bond Donor: 7H-Bond Acceptor: 11

InChIKey: VPSHHQXIWLGVDD-ZLUOBGJFSA-N

107208-63-9
H-ASP-ASP-OH (7 suppliers)
Compound Structure IUPAC Name: 2-[(2-amino-4-hydroxy-4-oxobutanoyl)amino]butanedioic acid | CAS Registry Number: 58471-53-7
Synonyms: Aspartyl-aspartic Acid, CID332965, NSC332639

Molecular Formula: C8H12N2O7Molecular Weight: 248.190080 [g/mol]
H-Bond Donor: 5H-Bond Acceptor: 8

InChIKey: FRYULLIZUDQONW-UHFFFAOYSA-N

58471-53-7
H-ASP-CYS-TYR-CYS-ARG-ILE-PRO-ALA-CYS-ILE-ALA-GLY-GLU-ARG-ARG-TYR-GLY-THR-CYS-ILE-TYR-GLN-GLY-ARG-LEU-TRP-ALA-PHE-CYS-CYS-OH,(DISULFIDE BONDS BETWEEN CYS2 AND CYS30/CYS4 AND CYS19/ CYS9 AND CYS29) (5 suppliers)
Compound Structure Synonyms: Human Defensin NP-1, alpha-Defensin-1, Human neutrophil peptide-1, Defensin HNP-1 (human), 148093-65-6, Neutrophil Peptide-1, .alpha.-Defensin-1, Defensin HNP-1 human, human neutrophil peptide 1, HNP-1, CHEMBL1213537, HUMAN NEUTROPHIL DEFENSIN 1, ACYCRIPACIAGERRYGTCIYQGRLWAFCC), Defensin HNP-1 human, >=80% (HPLC), LS-187008, LS-187643, 99287-08-8

Molecular Formula: C150H222N44O38S6Molecular Weight: 3442.056 [g/mol]
H-Bond Donor: 49H-Bond Acceptor: 49

InChIKey: KRJOFJHOZZPBKI-KSWODRSDSA-N

136661-76-2
H-ASP-D-PRO-HIS-ASP-PHE-D-TRP-VAL-D-TRP-LEU-NLE-NH2 (7 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[(2R)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-1-oxohexan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]carbamoyl]pyrrolidin-1-yl]-4-oxobutanoic acid | CAS Registry Number: 109212-72-8
Synonyms: (D-Pro2,D-Trp6,8,Nle10)-Neurokinin B

Molecular Formula: C67H87N15O14Molecular Weight: 1326.524 [g/mol]
H-Bond Donor: 15H-Bond Acceptor: 16

InChIKey: SBSGAKKSUHYFOA-KDICMADCSA-N

109212-72-8
H-ASP-GLN-OH (8 suppliers)
Compound Structure IUPAC Name: (2S)-5-amino-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-5-oxopentanoic acid | CAS Registry Number: 13433-13-1
Synonyms: aspartylglutamine, Asp-Gln, Aspartyl-Glutamine, L-alpha-Asp-L-Gln, L-Asp-L-Gln, alpha-aspartylglutamine, AC1LANFR, NH2-Asp-Gln-COOH, L-alpha-aspartyl-L-glutamine, CHEBI:73827, (2S)-5-amino-2-[[(2S)-2-amino-4-hydroxy-4-oxobutanoyl]amino]-5-oxopentanoic acid

Molecular Formula: C9H15N3O6Molecular Weight: 261.231900 [g/mol]
H-Bond Donor: 5H-Bond Acceptor: 7

InChIKey: GSMPSRPMQQDRIB-WHFBIAKZSA-N

13433-13-1
H-ASP-GLU-GLY-PRO-TYR-LYS-MET-GLU-TYR-PHE-ARG-TRP-GLY-SER-PRO-PRO-LYS-ASP-OH (4 suppliers)198281-81-1
H-ASP-GLY-OH (10 suppliers)
Compound Structure IUPAC Name: 3-amino-4-(carboxymethylamino)-4-oxobutanoic acid | CAS Registry Number: 3790-51-0
Synonyms: Aspartylglycine, MolPort-004-964-404, CID302429, NSC186907

Molecular Formula: C6H10N2O5Molecular Weight: 190.154000 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 6

InChIKey: JHFNSBBHKSZXKB-UHFFFAOYSA-N

3790-51-0
H-ASP-HIS-LEU-ASP-LYS-GLN-THR-GLN-THR-PRO-LYS-THR-OH (5 suppliers)823814-33-1
H-ASP-LEU-NH2 (5 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 17193-68-9
Synonyms: H-Asp-Leu-NH2, ZINC2560968, AKOS030623001

Molecular Formula: C10H19N3O4Molecular Weight: 245.279 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 5

InChIKey: ZEUUGTXTYVFFAY-BQBZGAKWSA-N

17193-68-9
H-ASP-LEU-OH (10 suppliers)
Compound Structure IUPAC Name: 2-[(2-amino-4-hydroxy-4-oxobutanoyl)amino]-4-methylpentanoic acid | CAS Registry Number: 3062-14-4
Synonyms: NSC332636, CID332962

Molecular Formula: C10H18N2O5Molecular Weight: 246.260320 [g/mol]
H-Bond Donor: 4H-Bond Acceptor: 6

InChIKey: ZVDPYSVOZFINEE-UHFFFAOYSA-N

3062-14-4
H-ASP-LYS-OH (7 suppliers)
Compound Structure IUPAC Name: (2S)-6-amino-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]hexanoic acid | CAS Registry Number: 5891-51-0
Synonyms: L-Aspartyl-L-lysine, Alpha-Aspartyl-lysine, CHEMBL66839, CHEBI:73829, alpha-Asp-Lys, alpha-aspartyllysine, L-alpha-Asp-L-Lys, L-Asp-L-Lys, L-alpha-aspartyl-L-lysine, N2-L-a-aspartyl-L-Lysine, N2-L-alpha-aspartyl-L-Lysine, AC1O530Q, SCHEMBL1308762, HMDB04987, DK, (2S)-6-amino-2-[[(2S)-2-amino-4-hydroxy-4-oxobutanoyl]amino]hexanoic acid

Molecular Formula: C10H19N3O5Molecular Weight: 261.274960 [g/mol]
H-Bond Donor: 5H-Bond Acceptor: 7

InChIKey: OAMLVOVXNKILLQ-BQBZGAKWSA-N

5891-51-0
H-ASP-MET-HIS-ASP-PHE-PHE-N-METHYL-PHE-GLY-LEU-MET-NH2 (6 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-1-amino-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-1-oxo-3-phenylpropan-2-yl]-methylamino]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 110880-53-0
Synonyms: (MePhe7)neurokinin B, CHEMBL583102, (N-Me-Phe7)-Neurokinin B, BDBM50299467, (5S,8S,14S,17S,20S,23S,26S,29S,32S)-26-((1H-imidazol-5-yl)methyl)-32-amino-14,17,20-tribenzyl-5-carbamoyl-23-(carboxymethyl)-8-isobutyl-15-methyl-29-(2-(methylthio)ethyl)-7,10,13,16,19,22,25,28,31-nonaoxo-2-thia-6,9,12,15,18,21,24,27,30-nonaazatetratriacontan-34-oic acid

Molecular Formula: C60H81N13O14S2Molecular Weight: 1272.505 [g/mol]
H-Bond Donor: 13H-Bond Acceptor: 18

InChIKey: FWEMQPXASKKIMV-UILVTTEASA-N

110880-53-0
H-ASP-MET-HIS-ASP-PHE-PHE-PRO-GLY-LEU-MET-NH2 (6 suppliers)
Compound Structure IUPAC Name: (3S)-3-amino-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[(2S)-2-[[2-[[(2S)-1-[[(2S)-1-amino-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]carbamoyl]pyrrolidin-1-yl]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-oxobutanoic acid | CAS Registry Number: 120814-48-4
Synonyms: (Pro7)neurokinin B, NCGC00167221-01

Molecular Formula: C55H77N13O14S2Molecular Weight: 1208.418 [g/mol]
H-Bond Donor: 13H-Bond Acceptor: 18

InChIKey: TTWKWWRHWRUGFW-GMIRWQTLSA-N

120814-48-4
H-Asp-OBzl.HCl (1 supplier)
501 to 550 of 23200 results  Page: << Previous 50 Results 1 2 3 4 5 6 7 8 9 10 [11] 12 13 14 15 16 17 18 19 20 >> Next 50 Results
Alphabetical Products   |   ALL 20,000 Suppliers
HomeBuyAdd FREE ListingAdvertise Chemical Company